o
ckF[;[ @ s d dl mZ d dlZd dlZd dlZd dlZd dlmZ d dlm Z d dl
Zd dl m Z d dl
mZ d dlmZmZ dZd ZG d
d d eZdS ) ) exceptionN)AWSAuthConnection)handler)ResourceRecordSetsZone)sixurlliba
%(name)s
%(caller_ref)s
%(comment)s
a`
%(name)s
%(vpc_id)s
%(vpc_region)s
%(caller_ref)s
%(comment)s
c s e Zd ZdZ dZ dZ dddddedddddf fdd Zd d
Zd2 fd d
Zd3ddZ dd Z
dd Z d4ddZ dd Z
dZd5ddZd3d d Zd d Zd d! Z d6d"d#Zd$d% Zd&d' Z d7d(d)Zd*d+ Zd,d- Zd.d/ Zd0d1 Z ZS )8Route53Connectionzroute53.amazonaws.comz
2013-04-01z-https://route53.amazonaws.com/doc/2013-04-01/Nr Tc s, t t| j|||d|||||| |
| d d S )NT)debugsecurity_tokenvalidate_certshttps_connection_factory profile_name)superr
__init__) selfaws_access_key_idaws_secret_access_keyportproxy
proxy_porthostr r r
r r __class__ 9/usr/lib/python3/dist-packages/boto/route53/connection.pyr L s
zRoute53Connection.__init__c C s dgS )Nroute53r r r r r _required_auth_capabilityZ s z+Route53Connection._required_auth_capability c sr |r+g }t |D ]\}}|d u rq ||d tjt| q |dd| 7 }tt | j
||||| j dS )N=?&)
retry_handler) r iteritemsappendr parsequotestrjoinr r
make_request_retry_handler) r actionpathheadersdataparamspairskeyvalr r r r+ ] s
z Route53Connection.make_requestc C s i }|rd|i}| j dd| j |d}| }tj| |jdkr+t|j|j |tj
j ddd}tj
|d }|
| |rJ|d
d | d |d
v rh|d
d }|d
d }| ||}d |d
v sP|S ) aA
Returns a Python data structure with information about all
Hosted Zones defined for the AWS account.
:param int start_marker: start marker to pass when fetching additional
results after a truncated list
:param list zone_list: a HostedZones list to prepend to results
markerGET/%s/hostedzoner1 , HostedZones)
HostedZone list_marker item_markerNListHostedZonesResponse
NextMarker)r+ Versionreadbotologr statusr DNSServerErrorreason jsonresponseElement
XmlHandlerr' extendget_all_hosted_zones) r start_marker zone_listr1 responsebodyeh next_markerr r r rL k s4
z&Route53Connection.get_all_hosted_zonesc C sv d| j |f }| d|}| }tj| |jdkr%t|j|j |tj
j ddd}tj
|d}|
| |S )z
Get detailed information about a particular Hosted Zone.
:type hosted_zone_id: str
:param hosted_zone_id: The unique identifier for the Hosted Zone
/%s/hostedzone/%sr6 r9 NameServers
NameServerr< NrA r+ rB rC rD r rE r rF rG rH rI rJ r' r hosted_zone_idurirO rP rQ rR r r r get_hosted_zone s
z!Route53Connection.get_hosted_zonec C sZ |d dkr
|d7 }| }|d d D ]}|d |kr*| |d dd S qdS ) z
Get detailed information about a particular Hosted Zone.
:type hosted_zone_name: str
:param hosted_zone_name: The fully qualified domain name for the Hosted
Zone
.r? r: NameId/N)rL r\ split)r hosted_zone_nameall_hosted_zoneszoner r r get_hosted_zone_by_name s z)Route53Connection.get_hosted_zone_by_nameFc C s |du r
t t }|r|||||| jd}t| }n |||| jd}t| }d| j } | d| ddi|}
|
} t j
| |
j dkr[t j
jd d
d } t j
| d}
|
| | S t|
j |
j| ) a^
Create a new Hosted Zone. Returns a Python data structure with
information about the newly created Hosted Zone.
:type domain_name: str
:param domain_name: The name of the domain. This should be a
fully-specified domain, and should end with a final period
as the last label indication. If you omit the final period,
Amazon Route 53 assumes the domain is relative to the root.
This is the name you have registered with your DNS registrar.
It is also the name you will delegate from your registrar to
the Amazon Route 53 delegation servers returned in
response to this request.A list of strings with the image
IDs wanted.
:type caller_ref: str
:param caller_ref: A unique string that identifies the request
and that allows failed CreateHostedZone requests to be retried
without the risk of executing the operation twice. If you don't
provide a value for this, boto will generate a Type 4 UUID and
use that.
:type comment: str
:param comment: Any comments you want to include about the hosted
zone.
:type private_zone: bool
:param private_zone: Set True if creating a private hosted zone.
:type vpc_id: str
:param vpc_id: When creating a private hosted zone, the VPC Id to
associate to is required.
:type vpc_region: str
:param vpc_region: When creating a private hosted zone, the region
of the associated VPC is required.
N)name
caller_refcommentvpc_id
vpc_regionxmlns)rg rh ri rl r7 POST Content-Typetext/xml rU rV r< )r) uuiduuid4 XMLNameSpaceHZPXMLHZXMLrA r+ rB rC rD r rE rH rI rJ r' r rF rG )r domain_namerh ri private_zonerj rk r1 xml_bodyr[ rO rP rQ rR r r r create_hosted_zone sD (
z$Route53Connection.create_hosted_zonec C p d| j |f }| d|}| }tj| |jdvr%t|j|j |tj
}tj
|d}|
| |S )z
Delete the hosted zone specified by the given id.
:type hosted_zone_id: str
:param hosted_zone_id: The hosted zone's id
rT DELETE NrX rY r r r delete_hosted_zone
z$Route53Connection.delete_hosted_zonez
%(caller_ref)s
%(health_check)s
c
C s |du r
t t }d| j }| j|| d}| j| }| d|ddi|}| }t j
| |j dkrIt j
}t j
|d} | | |S t|j |j|)a
Create a new Health Check
:type health_check: HealthCheck
:param health_check: HealthCheck object
:type caller_ref: str
:param caller_ref: A unique string that identifies the request
and that allows failed CreateHealthCheckRequest requests to be retried
without the risk of executing the operation twice. If you don't
provide a value for this, boto will generate a Type 4 UUID and
use that.
N/%s/healthcheck)rl rh health_checkrm rn ro rp )r) rq rr rA rs to_xml
POSTHCXMLBodyr+ rB rC rD r rE rH rI rJ r' r rF rG )
r r rh r[ r1 rx rO rP rQ rR r r r create_health_check s"
z%Route53Connection.create_health_checkc C s i }|dur
||d< |dur||d< d| j f }| jd||d}| }tj| |jdkr8t|j|j |tj
j dd d
}tj
|d}|
| |S ) z
Return a list of health checks
:type maxitems: int
:param maxitems: Maximum number of items to return
:type marker: str
:param marker: marker to get next set of items to list
Nmaxitemsr5 r r6 r8 r9 HealthChecks) HealthCheckr< rX ) r r r5 r1 r[ rO rP rQ rR r r r get_list_health_checks8 s(
z(Route53Connection.get_list_health_checksc C sr d| j }| d|}| }tj| |jdkr#t|j|j |tj
j ddd}tj
|d}|
| |S )z@
Return a list of Route53 healthcheck IP ranges
z/%s/checkeriprangesr6 r9 CheckerIpRanges)memberr< NrX )r r[ rO rP rQ rR r r r get_checker_ip_rangesX s
z'Route53Connection.get_checker_ip_rangesc C rz )z
Delete a health check
:type health_check_id: str
:param health_check_id: ID of the health check to delete
z/%s/healthcheck/%sr{ r| NrX )r health_check_idr[ rO rP rQ rR r r r delete_health_checki r z%Route53Connection.delete_health_checkc C s ||||d}d| j |f }| jd||d}| } tj| |jdkr.t|j|j | t
| |d}
t |
| } t
j| | |
S )a
Retrieve the Resource Record Sets defined for this Hosted Zone.
Returns the raw XML data returned by the Route53 call.
:type hosted_zone_id: str
:param hosted_zone_id: The unique identifier for the Hosted Zone
:type type: str
:param type: The type of resource record set to begin the record
listing from. Valid choices are:
* A
* AAAA
* CNAME
* MX
* NS
* PTR
* SOA
* SPF
* SRV
* TXT
Valid values for weighted resource record sets:
* A
* AAAA
* CNAME
* TXT
Valid values for Zone Apex Aliases:
* A
* AAAA
:type name: str
:param name: The first name in the lexicographic ordering of domain
names to be retrieved
:type identifier: str
:param identifier: In a hosted zone that includes weighted resource
record sets (multiple resource record sets with the same DNS
name and type that are differentiated only by SetIdentifier),
if results were truncated for a given DNS name and type,
the value of SetIdentifier for the next resource record
set that has the current DNS name and type
:type maxitems: int
:param maxitems: The maximum number of records
)typerg
identifierr /%s/hostedzone/%s/rrsetr6 r8 r9 )
connectionrZ )rA r+ rB rC rD r rE r rF rG r r rJ xmlsax parseString) r rZ r rg r r r1 r[ rO rP rsrR r r r get_all_rrsets s 4
z Route53Connection.get_all_rrsetsc C sx d| j |f }| d|ddi|}| }tj| |jdkr)t|j|j |tj
}tj
|d}|
| |S )a
Create or change the authoritative DNS information for this
Hosted Zone.
Returns a Python data structure with information about the set of
changes, including the Change ID.
:type hosted_zone_id: str
:param hosted_zone_id: The unique identifier for the Hosted Zone
:type xml_body: str
:param xml_body: The list of changes to be made, defined in the
XML schema defined by the Route53 service.
r rm rn ro r9 NrX )r rZ rx r[ rO rP rQ rR r r r
change_rrsets s
z Route53Connection.change_rrsetsc C sp d| j |f }| d|}| }tj| |jdkr%t|j|j |tj
}tj
|d}|
| |S )a
Get information about a proposed set of changes, as submitted
by the change_rrsets method.
Returns a Python data structure with status information about the
changes.
:type change_id: str
:param change_id: The unique identifier for the set of changes.
This ID is returned in the response to the change_rrsets method.
z
/%s/change/%sr6 r9 NrX )r change_idr[ rO rP rQ rR r r r
get_change s
z Route53Connection.get_changec C s$ | j ||||d}t| |d d S )a#
Create a new Hosted Zone. Returns a Zone object for the newly
created Hosted Zone.
:type name: str
:param name: The name of the domain. This should be a
fully-specified domain, and should end with a final period
as the last label indication. If you omit the final period,
Amazon Route 53 assumes the domain is relative to the root.
This is the name you have registered with your DNS registrar.
It is also the name you will delegate from your registrar to
the Amazon Route 53 delegation servers returned in
response to this request.
:type private_zone: bool
:param private_zone: Set True if creating a private hosted zone.
:type vpc_id: str
:param vpc_id: When creating a private hosted zone, the VPC Id to
associate to is required.
:type vpc_region: str
:param vpc_region: When creating a private hosted zone, the region
of the associated VPC is required.
)rw rj rk CreateHostedZoneResponser; )ry r )r rg rw rj rk re r r r create_zone s z Route53Connection.create_zonec C s. | |}| D ] }||jkr| S q dS )z
Returns a Zone object for the specified Hosted Zone.
:param name: The name of the domain. This should be a
fully-specified domain, and should end with a final period
as the last label indication.
N)_make_qualified get_zonesrg )r rg re r r r get_zone s
zRoute53Connection.get_zonec s" } fdd|d d D S )z
Returns a list of Zone objects, one for each of the Hosted
Zones defined for the AWS account.
:rtype: list
:returns: A list of Zone objects.
c s g | ]}t |qS r r ).0re r r r
0 s z/Route53Connection.get_zones..r? r: )rL )r zonesr r r r & s
zRoute53Connection.get_zonesc C sr t |tttfv r'g }|D ]}|r |d dks |d| q
|| q
|S | }|r7|d dks7d| }|S )z
Ensure passed domain names end in a period (.) character.
This will usually make a domain fully qualified.
r] r^ z%s.)r listtuplesetr& strip)r valuenew_listrecordr r r r 3 s z!Route53Connection._make_qualifiedc C s d }t jd|j |jdkrH| }t|j|j|}|jrH|jdvr'|S d|j|f }t t
d| t j ddd}|d 7 }|||f}|S )
NzSaw HTTP status: %si )PriorRequestNotComplete
ThrottlingServiceUnavailableRequestExpiredz%s, retry attempt %s Botomax_retry_delay< )
rC rD r rE rB r rF rG
error_codeminrandomconfigget)r rO i
next_sleeprE rP errmsgr r r r, F s,
z Route53Connection._retry_handler)Nr N)NN)Nr FNN)N)NNNN)FNN) __name__
__module__ __qualname__ DefaultHostrA rs r r r+ rL r\ rf ry r r r r r r r r r r r r r r,
__classcell__r r r r r
B sN
H
"
C
r
) boto.route53r r rq xml.saxr rC boto.connectionr r boto.jsonresponseboto.route53.recordr boto.route53.zoner boto.compatr r ru rt r
r r r r s